SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001265 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001265
Domain Number 1 Region: 19-496
Classification Level Classification E-value
Superfamily ALDH-like 1.06e-155
Family ALDH-like 0.000000000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001265   Gene: ENSTBEG00000001455   Transcript: ENSTBET00000001458
Sequence length 501
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3962:376040:429796:-1 gene:ENSTBEG00000001455 transcript:ENSTBET00000001458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSGTPDLPVPPTNLKIQYTIIFINNEWHDSVSGKKFPVFNPATEEKLCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLFSNAYL
MDLGGCIKTLRYCAGWADKIQGRTIPIXXXXXXXXXXXXXXXXXXXXXWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAXXXXXXXXXXX
XXXXXXXXXVGKMIKEAAGKSNLKRVTLELGGKSPCIVFADADLDNAVEFAHHGLFYHQG
QCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPLTPGVNQGPQIDKEQHDKILDLIES
GKKEGAKLECGGGPWGNKGYFIQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTSYGLSAGIFTKDIDKAVTVSSALQAGTVWVNCYSVVTAQCPFGGFKMSGNGRELGE
YGFHEYVEVKTVTMKISQKNS
Download sequence
Identical sequences ENSTBEP00000001265 ENSTBEP00000001265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]