SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001438 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000001438
Domain Number - Region: 15-107
Classification Level Classification E-value
Superfamily DNA clamp 0.00597
Family DNA polymerase processivity factor 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001438   Gene: ENSTBEG00000001667   Transcript: ENSTBET00000001655
Sequence length 277
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4372:152574:181746:-1 gene:ENSTBEG00000001667 transcript:ENSTBET00000001655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRAKIVDAACLNHFTRVSNMVAKLAKTCTLRITPDKLNFMLSDKLASGGVSMWCELEQ
ENSEKEIEGVTENNAIYLDLTSENLSRALKTAQNARALKIKLTNKHLDNLTVSLELLSVS
NSSRVVTHDIPVKVIPRKLWKDLHEPVVPDADVCIYLPVLKTMKSVVEKMRNISDHLVIE
ANRNGELNLKIETELVCVTTHFKDLGNPPLASGSASQDRNPEQMAEVRIDIRKLLQFLAG
QQVNPTKACCNIVNHKIIHFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences ENSTBEP00000001438 ENSTBEP00000001438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]