SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001652 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001652
Domain Number 1 Region: 30-106
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 0.000000000000131
Family Peptidyl-tRNA hydrolase-like 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000001652
Domain Number - Region: 172-206
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 0.0366
Family Peptidyl-tRNA hydrolase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001652   Gene: ENSTBEG00000001921   Transcript: ENSTBET00000001904
Sequence length 214
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2558:133280:134813:-1 gene:ENSTBEG00000001921 transcript:ENSTBET00000001904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSGLLGSRLWLSRAMSRCVLEPRPPGKRWLVAGLGNPGLPSTRHSVGMAVLGQLARRL
GVAESWERDRRCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYVLGCF
SPAEQELLPPLLDRATDLLLDHIRERRQEPSLGS
Download sequence
Identical sequences ENSTBEP00000001652 ENSTBEP00000001652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]