SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001665 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001665
Domain Number 1 Region: 14-145
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.18e-35
Family NadC N-terminal domain-like 0.00074
Further Details:      
 
Domain Number 2 Region: 412-520
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.61e-19
Family NadC C-terminal domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001665   Gene: ENSTBEG00000001903   Transcript: ENSTBET00000001919
Sequence length 563
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_108:55452:59757:-1 gene:ENSTBEG00000001903 transcript:ENSTBET00000001919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEWDPEGRAAYRPLLTDLYQATMALGYWHAGRAQDAAEFELFFRRCPFGGAFALAAGL
RDCVRFVRAFRLQDADVQFLASVLPPDTDPAFFDHLRALDGSGVTLRALPEGSLAFPGVP
LLQVSGPLLVVQLLETPLLCLISYAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEKQTLPGS
KAAFRLLGPDGSPMLDLLQLAEEPPPRAGQEMSVWPRAAQKPCLVRPAQVEPLLRLWVWQ
GQLCEPLPSLAESRAFAQLSLSSLRPEHRRPITPAPYQVGGAPAGCPVLHAPARSPTPLH
CSLVALSEKLQALVEALGRGGLP
Download sequence
Identical sequences ENSTBEP00000001665 ENSTBEP00000001665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]