SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001677 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001677
Domain Number 1 Region: 178-223
Classification Level Classification E-value
Superfamily Kringle-like 5.14e-16
Family Fibronectin type II module 0.0024
Further Details:      
 
Domain Number 2 Region: 118-170
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000103
Family Fibronectin type II module 0.0029
Further Details:      
 
Domain Number 3 Region: 27-69
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000799
Family Fibronectin type II module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001677   Gene: ENSTBEG00000001953   Transcript: ENSTBET00000001932
Sequence length 223
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4274:8919:28055:1 gene:ENSTBEG00000001953 transcript:ENSTBET00000001932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQWSSYLLGWMALLLYSYETSGDIKEDCVFPFTYKESVYFTCTKTNSFSPWCATRAVYD
GRWKHCMVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY
GGNSFSKPCIFPSIYRNNVISECIENESNKLWCPTTENMDKDGKWSFCADTRISSLVAGF
PCHFPFNYKNKNYFNCTNKGSKKNQLWCATSYNYDKDHTWVYC
Download sequence
Identical sequences ENSTBEP00000001677 ENSTBEP00000001677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]