SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001993 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001993
Domain Number 1 Region: 968-1107
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.65e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000165
Further Details:      
 
Domain Number 2 Region: 95-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000047
Family Calponin-homology domain, CH-domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001993   Gene: ENSTBEG00000002284   Transcript: ENSTBET00000002302
Sequence length 1113
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_500:592:12419:1 gene:ENSTBEG00000002284 transcript:ENSTBET00000002302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAHLAVIDALMVAFAFEWTKTLPGPLALPSLEHKLLFWVDTTVRRLQEKTEQEAAQRASP
AAPADGTAPAQPSIRYRKDRAVARRAPCFPNVTTLQDLASGAALAATIHCYCPQLLRLEE
VCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLALEDLLYVPPPLKVNLVVLLAEMFVCF
EVLKPDFVQVKDLPDGHAASPRGTEASPPQNTSGSSSPVFNFRHPLLSSGGPQSPLRGST
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAPLSSSQRDQRLSDQQQRFLAPPMASW
PAPPPAAWVIPGPTRPKAASPSPARRAQAARRSPGACPSPTPRSPKHARPAELRLAPLTR
VLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLAEGTPPEEPAARPALIEIPLGSLEAPAA
EEEGDGSPPGAEDSLEEEASSEGEPRAGLGFFYKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXSRLSKIYSQPTLSLSTVANETPNNLGVKRPTSRAPSPSGLVSPSRLPGSRERDWENGS
NASSPASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKAN
HFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPA
KTMSMSVDAFTIQGHLWQSKKPTTPKKGGSTPK
Download sequence
Identical sequences ENSTBEP00000001993 ENSTBEP00000001993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]