SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002035 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002035
Domain Number 1 Region: 108-142
Classification Level Classification E-value
Superfamily LysM domain 0.0000942
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002035   Gene: ENSTBEG00000002372   Transcript: ENSTBET00000002352
Sequence length 319
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4923:715104:725953:-1 gene:ENSTBEG00000002372 transcript:ENSTBET00000002352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGTLSRALGHDLAPHSGGGGGGLGCRLLAACPVLKTDFNMAGRHQNRSFPLLGVQSSGQV
HAFGNCTDSDVLEEDAEVYELRSRGKEKVRRSTSRDKLDDIVLLTKDIQEGDTLNAIALQ
YCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTETLYPPKGRQTSRPSSVPFTPEQ
EILPASDSFSSSESAGSFLKEVDRDIEQIVKCTDTTRENLDEVVSALTAQQTRFEPDNRN
TQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYYEILAKVDVSHHSTVDSSHLHSG
ITPSSQQREMENGIAPTKG
Download sequence
Identical sequences ENSTBEP00000002035 ENSTBEP00000002035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]