SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002119 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002119
Domain Number 1 Region: 493-529,649-786
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.25e-45
Family Phosphate binding protein-like 0.0000032
Further Details:      
 
Domain Number 2 Region: 260-393
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-18
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 20-106
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000135
Family L-arabinose binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002119   Gene: ENSTBEG00000002425   Transcript: ENSTBET00000002450
Sequence length 954
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3193:120846:497141:1 gene:ENSTBEG00000002425 transcript:ENSTBET00000002450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSRLYASNISDSLFNTTLVV
TTILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRRPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTTIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCEMVELRSIILCQDSVHPRRRRTGVPPPRPPVPEERRPRSTATLSNGKLCGAGEPDQLA
QRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKITNSSEPE
Download sequence
Identical sequences ENSTBEP00000002119 ENSTBEP00000002119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]