SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002224 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002224
Domain Number 1 Region: 256-337
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.62e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 2-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002224   Gene: ENSTBEG00000002540   Transcript: ENSTBET00000002568
Sequence length 805
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2095:237744:360037:-1 gene:ENSTBEG00000002540 transcript:ENSTBET00000002568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEI
RQDWKPTFLSNEEFTQLMLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDLVDQSIFX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNQLEFCCHMLRGTIDPKEPSTYEYVKFI
GNFKSLNSVSTSAHNGFETIQRTHRPSFDRCFVATVRLATPQFIRXXXXXXXXXXXXXXX
XXXXXXXXXXXXXAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYY
RFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETA
ADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXFSSQSINSQSVGPSLTQPVMSQAANLPIPQGMSQFQFSAQ
LGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSV
QLSSGNSSNIQQLTPINMQGQVVPTSQIQSGMGTGHIGTTQHMIQPQTLQSASAQSQQNV
LSGHNQQTSLPSQTQGTLTAPLYNTMVISQPAAGSMVQIPSSIPQNSTQSAVTTFTQDRQ
IRFSQGQQLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQ
HQSQQQQQLSRHRTDSLTDPSKVPP
Download sequence
Identical sequences ENSTBEP00000002224 ENSTBEP00000002224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]