SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002549 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002549
Domain Number 1 Region: 1645-1867
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-83
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000179
Further Details:      
 
Domain Number 2 Region: 1929-2172
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.5e-68
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000163
Further Details:      
 
Domain Number 3 Region: 1-204
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.18e-55
Family Carbonic anhydrase 0.0000518
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000002549
Domain Number - Region: 215-263
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000667
Family Fibronectin type III 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002549   Gene: ENSTBEG00000002906   Transcript: ENSTBET00000002951
Sequence length 2202
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2114:95614:215927:1 gene:ENSTBEG00000002906 transcript:ENSTBET00000002951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTGKTVEINLTNDYRLSGGISEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIY
CFDADRFSSFEEAVKGKGKLRALSILFEVGMEENLEYKAIIDGVESVSRFGKQAALDPFI
LLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVM
LMDYLQNNFREQQYKFSRQVFSSYTGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPR
VVYDTMIEKFAVLYQQLEGEDQTKHELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLDLFPELIGTEEIIKEEEEGKDIEEDSIVNPGRDSATNQIRKK
EPHISTTTYYNRVGTKYNEAKTNRSPTRGSEFSGKADVPKIAFSSTSQPVTELATEKGIF
LTSHMATELPPHTVEGTKTVLRYPLVNFSGTAESLNAVSVTEYEEENLLTSFKLDTGADD
SSGSSPATSATPSTSENISHGYIFSSENPEAITYDVLIPESVRNASEGSASSGSEESLKD
PSVDGSVWFPSSADVTRQPDGGSGRESLLHTNFTEIQTDESQETAESFSPGPVMSQGPSV
TDMEMPHYSTFAYFPTEVTPHALTPSTGQHDSVPTVNVVHLQTTQPVSNGETLLQPSYSS
EVFPLVTPLLLDNQILNTTLAASSSDSALHATPVFPSVGVSFESILSSYESAPLLPFSSA
SSSSESFRHLHTVSQILPQVTSATESDQGSLHASLPMAGGDLLLEPSLVQYSDVGSHQTT
AYAASETLGFGSESGVLYKTLMFSQVPSGSDAXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEMLHSAPVPVF
DAPTSNMHPASLQGLTVSYTSEKYEPSLLKSEHFQQVVPSLYTQDELFQTADLEIKQAML
PKGRHAFATPVLSIDEPPNTLINQFLYSGEVFTSTESAAMDEVLAGIPTVVSDTLVSAHP
SISLGNGYVSPNRDSSSTTTKWLFPSKAISKVAPSADGRGGSENDIDDDDDDDDDDDDRD
SDGLSISKCMSCSAYRESQEKVMNESDAQENRLVDQNDPISYLPSENSEEENKVTGVTSD
SLTGMDTSPDRSPSTNALPSKHNDGKEEDGVPTGSALLPFTPESKAWAVLTSDEESGSGQ
GTSDSLNDNETSTDFSFPDITERDADGVLETGDSEITPGSPQSSTPSVTNRHSEVVNVSE
AEASNSSHESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYL
EDSTSPRVISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFEXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHSRVKLAQLAEKDGKLTDYINANYVDGYNR
PKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFL
VNQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLT
FVRKAAHAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRN
YLVQTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXSPALKQCNREKNRASSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFI
ITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMA
EEHKCLSNEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISIIKEEAA
TRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSMDVYQVAKMINLMRPGVFTDIEQYQ
FLYKAVLSLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV
Download sequence
Identical sequences ENSTBEP00000002549 ENSTBEP00000002549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]