SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002572 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002572
Domain Number 1 Region: 250-426
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000518
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000002572
Domain Number - Region: 108-149
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.0144
Family Rabenosyn-5 Rab-binding domain-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002572   Gene: ENSTBEG00000002987   Transcript: ENSTBET00000002978
Sequence length 434
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2191:12020:25936:1 gene:ENSTBEG00000002987 transcript:ENSTBET00000002978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPANPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAIKAKMDDLRPLIPVLEE
YKADAKLVLQKEEVQNLTSVLNELQEEIGAYDYDELQSRVSNLEERLRACMQKLXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVWYMDGYHNNRFVREYKSMADFMNTDNFTS
HRLPHPWSGTGQVVYNGSIYFNKFQSHIIIRFDLRTEAILKTRSLDYAGYNNMYHYAWGG
HSDIDLMVDENGLWAVYATNQNAGNIVISKLDPTSLQVLQTWNTSYPKRSAGEAFIICGT
LYVTNGYSGGTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQIL
YNVTLFHVIRSDEL
Download sequence
Identical sequences ENSTBEP00000002572 ENSTBEP00000002572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]