SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002621 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002621
Domain Number 1 Region: 60-172
Classification Level Classification E-value
Superfamily DNA-binding domain 2.39e-28
Family Methyl-CpG-binding domain, MBD 0.00055
Further Details:      
 
Domain Number 2 Region: 465-515
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.0000000294
Family Mismatch glycosylase 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002621   Gene: ENSTBEG00000003041   Transcript: ENSTBET00000003034
Sequence length 573
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2129:234:41433:-1 gene:ENSTBEG00000003041 transcript:ENSTBET00000003034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMAGMESPKLEDGGAAPLVTASERLVPNQQGDLRKEDIAVGLERMEEEEKQTVISSSSE
CNPLLQESIGSAQSGDVAMTECRKSAPCGWERVVKQRLSGKTAGRFDVYIISPQGLKFRS
KSSLARYLCKHGETSLTLEDFDFTVPSRRGIRSTHKDCSLAAPASQLQSESHSAGRSPRT
RSRWKKDVSPLPSSRSELQDSREPSGFSSTHLPLRKDGGVNDTKRGKVRKSERKATSLKA
PQNKKHKGGCRKSRSFAIRSDRRRSGYSETAADRGPAVQDNQLEQTPCLSNARTSDETLH
VTHEEKSLIKENSLGSESHFHFEPITSGLLRWTQEAELSEKHEDTFLDAKEVRRKVDVGE
RKEHLHTDIFKGGSELENNCPETKKERAFEKVSQXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMAIPVLWEFLEKYP
SAEARAADWREVSEILKPLGLYDLRAKTIIRFSXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVHPEDHKLNKYHDWLWENYEKLSLS
Download sequence
Identical sequences ENSTBEP00000002621 ENSTBEP00000002621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]