SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002655 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002655
Domain Number 1 Region: 455-560,682-723
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.3e-31
Family Phosphate binding protein-like 0.00000261
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000002655
Domain Number - Region: 227-285
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00029
Family L-arabinose binding protein-like 0.028
Further Details:      
 
Domain Number - Region: 623-655
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0628
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002655   Gene: ENSTBEG00000003053   Transcript: ENSTBET00000003072
Sequence length 1420
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3210:35946:399692:-1 gene:ENSTBEG00000003053 transcript:ENSTBET00000003072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPRTECCSPKFWLVLAVLAVSGSRARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVIPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIVSENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYW
QFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRT
AKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYIS
EVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSASSIDGLYDCDNPPFTTQPRSISKKPLD
IGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRDFYLDQFRSKENSP
HWEHVDLTDIYKERSDDFKRDSVSGGGPCANRAHLKHGTGDKHGVVSGVPAPWEKNLTNV
EWEDRSGSNFCRSCPSKLHNYSTTVAGQNSGRQACIRCEACKKAGNLYDISEDNSLQELD
QPAAPVAVPSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSL
KDKGRFLDGSPYAHMFEMPAGESTFANNKSSVPTAGHHHHNNPGSGYMLSKSLYPDRVTQ
NPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKARPDFRALVTNKPVVSALHGAVPGRFQK
DICXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSIESDV
Download sequence
Identical sequences ENSTBEP00000002655 ENSTBEP00000002655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]