SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002762 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002762
Domain Number 1 Region: 495-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.58e-61
Family Eukaryotic proteases 0.0000000048
Further Details:      
 
Domain Number 2 Region: 112-213
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-36
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 301-386
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-32
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 4 Region: 381-477
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-28
Family Kringle modules 0.00045
Further Details:      
 
Domain Number 5 Region: 210-250
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000193
Family Kringle modules 0.0014
Further Details:      
 
Domain Number 6 Region: 86-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000188
Family Hairpin loop containing domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002762   Gene: ENSTBEG00000003175   Transcript: ENSTBET00000003191
Sequence length 728
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_132:207857:301382:-1 gene:ENSTBEG00000003175 transcript:ENSTBET00000003191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPVLLLQHVLLHLLLLPIAIPYAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXAFVFDKARKRCHWFPFNSMSSGVKKEFDHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSTTNDTDVPM
ETTECIQGQGEGYRGTTNTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSRGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNKNHCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCSKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDERRKQVLNVSQLVYGPEGSDLVLLKLARPALLDDFVSTIDLP
NYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQHHQGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQNKMRMLLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
Download sequence
Identical sequences ENSTBEP00000002762 ENSTBEP00000002762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]