SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002997 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002997
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.000000719
Family Ribosomal L11/L12e N-terminal domain 0.00062
Further Details:      
 
Domain Number 2 Region: 43-96
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000017
Family Ribosomal protein L11, C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002997   Gene: ENSTBEG00000003467   Transcript: ENSTBET00000003457
Sequence length 110
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1098:201971:202401:1 gene:ENSTBEG00000003467 transcript:ENSTBET00000003457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPSKTEVVYPRCTGAEVTATSALVPKIGPLGLLRALREQKSIKHSGNSTSDRIVC
VARQVRQRSLARELSGTMRELGTAQSVGRDVDGCHPHDIIDDINSGTVYP
Download sequence
Identical sequences ENSTBEP00000002997 ENSTBEP00000002997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]