SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003034 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003034
Domain Number 1 Region: 456-558
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.99e-34
Family Eukaryotic proteases 0.0000201
Further Details:      
 
Domain Number 2 Region: 211-302
Classification Level Classification E-value
Superfamily Kringle-like 5.39e-30
Family Kringle modules 0.0000291
Further Details:      
 
Domain Number 3 Region: 105-179
Classification Level Classification E-value
Superfamily Kringle-like 9.87e-18
Family Kringle modules 0.00064
Further Details:      
 
Domain Number 4 Region: 39-85
Classification Level Classification E-value
Superfamily FnI-like domain 2.69e-16
Family Fibronectin type I module 0.00051
Further Details:      
 
Domain Number 5 Region: 299-362
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000000138
Family Eukaryotic proteases 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003034   Gene: ENSTBEG00000003502   Transcript: ENSTBET00000003498
Sequence length 560
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_598:269650:282498:-1 gene:ENSTBEG00000003502 transcript:ENSTBET00000003498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTAMQGELLCVLLLCGAGLTLPSQXXXXXXXXXXXXXXXTCRDEQTQTTYQLHEAWLRPL
LRGNRVEYCRCMSGRPLCHSVPVKSCSEPRCFNGGACRQALYFSDFVCQCPEGFVGKRCE
VDTRATCYEGQGITYRGTWSSTDSGAECTNWNSSALTRKPYSARRPDASKWGLGNHNYCX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRGDCYFGKGLAYRGTHGFTTSGASCLQW
DSLILLGKTYTARKSNAQALGLGGHNYCRNPDGDDKPWCHVLKDRKLTWEYCDLPQCSTC
GLRQYKQPQFRIKGGLFTDISSHPWQAAIFVKNRRASGERFLCGVLISSCWVLSAAHCFX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPSFSERLKEAHVRLYPASRCTSQHLF
NRTVTDNMLCAGDTRSGGNHANLHDACQGDSGGPLVCLQDNHMTLVGIISWGIGCGQRDV
PGVYTKVTNYLHWIQDNTRP
Download sequence
Identical sequences ENSTBEP00000003034 ENSTBEP00000003034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]