SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003041 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000003041
Domain Number - Region: 142-190
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00283
Family Ribosomal protein S4 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003041   Gene: ENSTBEG00000003521   Transcript: ENSTBET00000003505
Sequence length 240
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5896:55262:63838:1 gene:ENSTBEG00000003521 transcript:ENSTBET00000003505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTSVRLFTSVLRKPDAWIGLWGMLRGTPSNKLCASWNQYLHFSSAKLNASNYKTLFHN
IFSLRLPGLFISPEYIFPFSMRLKSNISSKKSTKTTLQKVEDDVDSDEESDRNATREQEE
EFEDDPSVAKDYKDLEKVVQSFRYDIILKTGLDIGRNKVEDAFYKGELRLNGDKLWKKSR
TVKVGDTLDILIGEDKEAETETVMRILLKKVFEEKTESEKHRVVLRRWKHLKLPKKSVSK
Download sequence
Identical sequences XP_006157016.1.99106 ENSTBEP00000003041 ENSTBEP00000003041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]