SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003279 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003279
Domain Number 1 Region: 67-163
Classification Level Classification E-value
Superfamily FKBP-like 8.5e-29
Family FKBP immunophilin/proline isomerase 0.00000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003279   Gene: ENSTBEG00000003793   Transcript: ENSTBET00000003777
Sequence length 163
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2077:45:15061:1 gene:ENSTBEG00000003793 transcript:ENSTBET00000003777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEKLPPGWEKRMSRSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Download sequence
Identical sequences ENSTBEP00000003279 ENSTBEP00000003279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]