SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003360 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003360
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.49e-34
Family Ribosomal protein S7 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003360   Gene: ENSTBEG00000003880   Transcript: ENSTBET00000003869
Sequence length 137
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_4944:14227:16315:1 gene:ENSTBEG00000003880 transcript:ENSTBET00000003869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVLARSLITQTLEAVKRKQFEKYRAASAEERANIERNPYTIFHQALKNCEPVIGLVPILK
GGHFYQVPVPLADRRRRFLAMKWMITECRENKHRRTLMPEKLSNELLEAFHNQGPVIKRK
HNMHMVEANRALAHYRW
Download sequence
Identical sequences ENSTBEP00000003360 ENSTBEP00000003360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]