SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003397 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003397
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000184
Family LEM domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003397   Gene: ENSTBEG00000003922   Transcript: ENSTBET00000003910
Sequence length 180
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5167:43339:69387:-1 gene:ENSTBEG00000003922 transcript:ENSTBET00000003910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVQCLSDYELQKQLEKLGFSPGPILPSTRKVYEKKLVQLLVSPPCAPPVMNGPREPDG
PQGSDDGKELNIILKGNITFSTKKSKEPKKRPEAPIIKPKAVDVYHPAYKPSRRIRCAAR
APNIRIKGRTVPRETAGCQADWSMESTAGGFPAGLKLAVLGIVLIVVFVYITVEKKPLFG
Download sequence
Identical sequences ENSTBEP00000003397 ENSTBEP00000003397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]