SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003409 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003409
Domain Number 1 Region: 71-116
Classification Level Classification E-value
Superfamily LysM domain 0.00000000115
Family LysM domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003409   Gene: ENSTBEG00000003951   Transcript: ENSTBET00000003928
Sequence length 215
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5194:468720:483809:-1 gene:ENSTBEG00000003951 transcript:ENSTBET00000003928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSPAPSLREGGPRAPRPPGPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRA
PLGAGVIERHVEHRVRAGDTLQGIALKYGVSMEQIKRANKLFTNDCIFLKKTLSIPVISE
KPSLFNGLNSIESPENETVDSSFSQEEEPVLAEEKLSPPSPQESDIKPVKLEEVSARDFL
QRLDLQIKLSTQAAKKLKEESRDEESPYATSLYHS
Download sequence
Identical sequences ENSTBEP00000003409 ENSTBEP00000003409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]