SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003425 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003425
Domain Number 1 Region: 103-480
Classification Level Classification E-value
Superfamily ALDH-like 7.28e-69
Family ALDH-like 0.0000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003425   Gene: ENSTBEG00000003918   Transcript: ENSTBET00000003945
Sequence length 482
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3942:6321:114573:-1 gene:ENSTBEG00000003918 transcript:ENSTBET00000003945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLLINQPQYAWLKELGLREENEGVYNGSWGGRGEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSLEMGKILVEGVGEVQ
EYVDICDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIA
MICGNVCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXLELGGTMPLIVFEDADLSLVVPSALFAAVGTAGQ
RCTTARRLFLHENIHDEVVNRLKKAYAQIRVGNPWDXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVMDRPGNYVEPTIVTGLAHNASIAHTETFAPILYVFKFKEEEEVFAWR
EVRQESSSSIFSKPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRR
ST
Download sequence
Identical sequences ENSTBEP00000003425 ENSTBEP00000003425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]