SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003426 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003426
Domain Number 1 Region: 404-518,638-783
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.04e-46
Family Phosphate binding protein-like 0.00000000832
Further Details:      
 
Domain Number 2 Region: 35-385
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.28e-44
Family L-arabinose binding protein-like 0.0067
Further Details:      
 
Domain Number 3 Region: 534-637
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000294
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003426   Gene: ENSTBEG00000003924   Transcript: ENSTBET00000003946
Sequence length 902
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3449:137183:463250:1 gene:ENSTBEG00000003924 transcript:ENSTBET00000003946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSFDLCTGFLEPVITQFSNXXXXXGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIV
DISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFV
LQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTE
EGYRMLFQDLEKKKERLVVVDCESERLNAILGQXXXXXXXXXXXXXXXXXXGFMDIDLNK
FKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAE
AFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRLEGWTGNVQFNEKGRTN
YTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLK
KNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVY
GXXXXXXXXXXXXXXXXXXXXXXXPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCI
VFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGC
DISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGT
LEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMN
EYIEQRKPCDTMKVGGNLDSKGYGIATKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDK
GECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCL
IPQQSINEAIRTSTLPRNSGAGASGSGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGAT
GL
Download sequence
Identical sequences ENSTBEP00000003426 ENSTBEP00000003426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]