SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003664 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003664
Domain Number 1 Region: 286-377
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.31e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003664   Gene: ENSTBEG00000004202   Transcript: ENSTBET00000004235
Sequence length 1116
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4795:73851:81904:-1 gene:ENSTBEG00000004202 transcript:ENSTBET00000004235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMTALRE
LKLRLPPERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCAMDMSTYTLEE
LEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGVLLRCKRDVFRGARFSELLAPQDVG
VFYGSTAPSRLPTWGTGASAGSGLKDFTQEKSVFCRIRGGPDRDPGPRYQPFRLTPYVTK
IRVSDGAPAQPCCLLIAERIHSGYEXXXXXXXXXXXXXXXXXXXXFQDVDERAAPLLGYL
PQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGF
VHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPALSLDPDIQELSEQIHRLLLQPCHSP
RTSGLCGVGPVTSPGPLHSPGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPSQAPLTSAPEEGERKEASSCS
YQQINCLDSILRYLESCNIPSTTKRKCASSSSYTASSASDDDKQRTGSVPLGAKKDPSSA
VLPGEGATPRKEPVVGGTLSPLTLANKAESVVSVTSQCSFSSTIVHVGDKKPPESXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPSPVPP
SAPWPPPPATTPFPAVVQPYSLPVFSPRGGSQPLPPAPTSVPPAAFPAPLVTPMVALVLP
NYLFPTPSSYPYGVPQPPAEGPPTPASYSPSPSLPPLPPSPPHHPDSPLFNSRCSSPLQL
NLLQLEELPRAEGGAIAGGPGSNAGPPPPNEEAAEPEARLVEVTESSNQDALSGSSDLLE
LLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRDSQSSHTSKYFGSIDSS
EAEAGAARARAEPGDQVIKYVLQDPIWLLMANADQRVMMTYQVPSRDMASVLKQDRERLR
AMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVV
Download sequence
Identical sequences ENSTBEP00000003664 ENSTBEP00000003664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]