SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003739 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003739
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.36e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 7-44
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000017
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000003739
Domain Number - Region: 275-320
Classification Level Classification E-value
Superfamily ARM repeat 0.00633
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003739   Gene: ENSTBEG00000004305   Transcript: ENSTBET00000004328
Sequence length 372
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_843:919769:960353:-1 gene:ENSTBEG00000004305 transcript:ENSTBET00000004328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTXXXXXXXXXXXXXXFH
DEQQLLLPVQQHQPQQQQHHHHHQQTQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSK
LIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVL
QQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPT
PAQAQITAAGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGA
EDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRD
YIFSKAIGDAEW
Download sequence
Identical sequences ENSTBEP00000003739 ENSTBEP00000003739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]