SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003825 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003825
Domain Number 1 Region: 442-581,698-716
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 1.05e-48
Family Substrate-binding domain of HMG-CoA reductase 0.000000152
Further Details:      
 
Domain Number 2 Region: 584-700
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 3.92e-44
Family NAD-binding domain of HMG-CoA reductase 0.000000517
Further Details:      
 
Domain Number 3 Region: 815-858
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 0.000000000000628
Family Substrate-binding domain of HMG-CoA reductase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003825   Gene: ENSTBEG00000004419   Transcript: ENSTBET00000004431
Sequence length 867
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1442:48492:95790:1 gene:ENSTBEG00000004419 transcript:ENSTBET00000004431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASALAKFALSSNSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVRQLEIMCCFGCMSVLANYFVFMTFFSACVSLVLELSRESREGRPIWQLSHFAR
VEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPHNSTAENSKMSLGLDENVSKRI
EPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQAETESTLSLKNPITSPVVTQ
KKVPDNCCRREPGLVRSNQKFQSVEEETGINQERKVEVIKPLVAETDTSNRATFVVGNSF
DTSSDLATQESEVELPREPRPNEECLQILANAEKGAKFLSDAEIIQLVDAKHIPPYKLET
LMETHERGVSIRRQLLSKKLPEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVAGP
LCLDGKEFQVPMATTEGCLVASTNRGCRAIGLGGGATSRILADGMTRGPVVRLPRACDSA
EVKAWLETPEGFTVIKEAFDSTSRFARLQKLHMSMAGRNLYIRFQSKSGDAMGMNMISKG
TEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLGVQGACKDNPGENARQLARIVC
GTVMAGELSLMAALAAGHLVRSHMIHN
Download sequence
Identical sequences ENSTBEP00000003825 ENSTBEP00000003825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]