SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003978 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003978
Domain Number 1 Region: 10-54
Classification Level Classification E-value
Superfamily LysM domain 0.00000000902
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003978   Gene: ENSTBEG00000004600   Transcript: ENSTBET00000004617
Sequence length 757
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3939:58453:134126:1 gene:ENSTBEG00000004600 transcript:ENSTBET00000004617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVS
SVESSPSLSPISPLSPTSSEAEFDKTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGTVSGVLLVTPNNIMFDPHKTDPLVQENGCEEYGIMCPMEEVM
SAAMYKDILDSKIKESLPIELDQLSGRDFCHSKKVTRSNTDEIDSRIRDAGNDSASTAPR
STEGSLSEDVFTESELSPIREELVSSDELRQDKSSGASSESVQTVNQTEPECLIVKSEPT
STSGHLKSDTVHSTNEAGTLSHKADLNNLEMATKGEDQVTGNVQEITAPKEQSTSIKGNA
DQDIFLHENLLHQEGEKENIPCGEATELKQKQSDNKGKQGKEQNRDSESEVEELRKLWKT
HTMQQTKQQRENIQQVSQKEIKHKIASADGHVEGSVLLKEKRRHRLHKFLCLRVGKPMRE
TFVSQASATMQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDTGEYTREPGFIV
VKKIEESETNEDPTNQAAAREWEITTREDINSKQVAPVKTDLESETFRPNLSDPSELLLP
DQIEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEFALWL
DGDLYHGRSHSCKTFGNHTLSKKEDFFIQDIEIWAFE
Download sequence
Identical sequences ENSTBEP00000003978 ENSTBEP00000003978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]