SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004002 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004002
Domain Number 1 Region: 553-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-53
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 4-46,85-206
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000209
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004002   Gene: ENSTBEG00000004625   Transcript: ENSTBET00000004644
Sequence length 824
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1234:52563:147018:-1 gene:ENSTBEG00000004625 transcript:ENSTBET00000004644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLGSTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDPVLQIPTHVEXXXXXXXXX
XXXXXXXXXXXXXXXXKLPFTIPELVQASPCRSSDGILYMGKKQDIWYVIDLLTGEKQQT
LSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYFDYAASLPEDDMDYKMSHF
VSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLKKVMHINVAVETLRYLTFMSG
EVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMVHEGVAVVPRGSTLPLLEG
PQTDGVTIGDKGECVITPSTDLKFDPRLKEKHKLNYLRNHWLLIGHHETPLSASTKMLER
FPNNLPKHRENVIPAESEKKSFEEVINLVDQAAKNAPTTVSQDVEEKFAHAPAKPEAPMD
SMLKDMATIILSTFLLIGWVAFIITYPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
EETSMVMVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRE
SDEHPNVIRYCTERDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPIALLQQTTSGLAHL
HSLNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIA
PEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGAYSLDRFHPEK
HEDVIAQELIEKMIAMDPQKRPSATHVLKHPFFWSLEKQLQFFQ
Download sequence
Identical sequences ENSTBEP00000004002 ENSTBEP00000004002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]