SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004027 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004027
Domain Number 1 Region: 260-344
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.57e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000798
Further Details:      
 
Domain Number 2 Region: 93-146
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000655
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000004027
Domain Number - Region: 11-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000366
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004027   Gene: ENSTBEG00000004645   Transcript: ENSTBET00000004672
Sequence length 862
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4400:642793:759906:1 gene:ENSTBEG00000004645 transcript:ENSTBET00000004672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKEKKRSSEEKKENPEDAARCRRSKETKFYELAHELPLPQSISSHLDKASIMRLAIS
FLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLT
QVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDVSTERDFFMRMKCTVTNRGRT
VNLKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXITELIGYHPEELLGRSAYEFYHALDSESMTKSHQNLCTKGQV
VSDQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESL
FKPHLMAMNGIFDNGGDMAASEKSNFLFTKLKEEPEELAQQAPTPGDAIISLDFGNQNFE
ESSAYGKAILSPNQPWATELRSHNTQSEAGSLPAFTVPQAAAPGSSTPSATSNSSCSTXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTDFNELDLETLAPYIPMDGEDFQLS
PICPEERLLPENPQPTPQHCLSAMTNIFQPLAPLASHSPFLLDKYQQQLENKKTEPEHRP
MSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWPAGDQHTEPLG
APPLGPVTSPHLXXXXXXSAKGFGPRGPDVMSPAMVALSNKLKLKRQLEYEEQAFQDMSG
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFTKLMRGLGQPRHCTPQHRP
PPSPRENAKSGFPSQCYAQYQDYSLPAAHKGSGVASRLLGPSFEPYLLPELTRYDCEVNV
PVPGSSTLLQGGDLLRALDQAT
Download sequence
Identical sequences ENSTBEP00000004027 ENSTBEP00000004027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]