SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004036 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004036
Domain Number 1 Region: 649-753
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.33e-16
Family Phosphate binding protein-like 0.00000447
Further Details:      
 
Domain Number 2 Region: 149-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000102
Family L-arabinose binding protein-like 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000004036
Domain Number - Region: 7-58
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0011
Family L-arabinose binding protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004036   Gene: ENSTBEG00000004666   Transcript: ENSTBET00000004682
Sequence length 768
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_3838:5:160758:-1 gene:ENSTBEG00000004666 transcript:ENSTBET00000004682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIFEYADGPNAQVMNAEEHAFRFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLK
EMKRGREFRIIFDCSHAMAAQILKQXXXXXXXXXXXXXXXXXXDLYALDLEPYRYSGVNL
TGFRILNVDNPHVSAIVEKWSMERLQAAPRAESGLLDGVMMTDAALLYDAVHIVSVCYQR
APQMTVNSLQCHRHKAWRFGGRFMNFIKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQTKEYGVKATMTFFKKSKDST
FEMRWAFMISKPSALVKNNEEGIQRTRTADYALLMESTTIEYVTQRNCNLTQIGGLIDSK
GYGIGTPMGSPYRDKITIAILQLQEEDKLHIMKKCASSGCPEEDKEAS
Download sequence
Identical sequences ENSTBEP00000004036 ENSTBEP00000004036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]