SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004275 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004275
Domain Number 1 Region: 305-416,538-580
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-31
Family Phosphate binding protein-like 0.00000444
Further Details:      
 
Domain Number 2 Region: 5-122
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000004
Family L-arabinose binding protein-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004275   Gene: ENSTBEG00000004941   Transcript: ENSTBET00000004966
Sequence length 1092
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5193:261423:269322:-1 gene:ENSTBEG00000004941 transcript:ENSTBET00000004966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLEGVRAVADASYLSW
RLLDVLTLELGPGGTRARTQRLLQVDAPVLVAYCSREEAEVLFVAAAGLVGLGHVWLVPN
LPGSTGTAPCNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVIVESRPGGGCVPNVPCRHSIQTF
SGGDTAPYTKLCCKGFCIDILKKLAKVVKFSYDLYLVTNGKHGKRVRGVWNGMIGEVYYK
RADMAIGSLTINEERAEVVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFV
MCLTVVAITVFMFEYFSPVSYNQNLTRGKKPGGPSFTIGKSVWLLWALVFNNSVPIENPR
GTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDRKFQRPQDQYPPFRFG
TVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKMGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETQKLETVWLSGICQNE
KNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFSWEHLVYWKLRHSVPNTPQLDFLLAFSR
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPAGCT
GPACAHRDSHPACRRLAQAQSMQLPSYREACQDGVPAGVLAPQHRAHVCLHAHAHLPFCW
GAVCSHLPPCASHSPWLTQAWEPPAHRGRTPGPSTGYRDSGGLEEVSRVACGRQGFPGPC
TWRRTSSLESEV
Download sequence
Identical sequences ENSTBEP00000004275 ENSTBEP00000004275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]