SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004286 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004286
Domain Number 1 Region: 442-517
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 231-285,312-335
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000321
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 147-207
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 
Domain Number 4 Region: 623-786
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00000093
Family Tetraviridae-like VP 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004286   Gene: ENSTBEG00000004928   Transcript: ENSTBET00000004979
Sequence length 841
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2911:240592:303183:-1 gene:ENSTBEG00000004928 transcript:ENSTBET00000004979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDSAVAVAAVGRRFWGVALPSSSRVRWRRLLPGGRGGGGSYGHGGDYCPGXXXXXXXXXX
XXXXXXXXXMSADVPSLGPAIASGNPGSGIQGGGAIVQRAIKRRPGMEFDDDGEGNSKYL
XXXXXXXXXXXXXXXXSDDEQSSADKERLARENHSEIERRRRKMTAYITELSDMVPTCSA
LARPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCE
TGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTG
TVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDPVSMNRLSFVRNRCXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXDDPEAGQGSKFCLVAIGRLQVXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMF
RFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPT
ANIPLEMGSGQLAPRQQQQQTELDIVPGRDGLASYNHSQVSVQPVTTTGPEHSKPLEKSE
GLFAQDRDPRFSEIYSNISADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLA
PPVTIVQPSASAGQMLAQISRHSNPTQGTAPTWTPSTRPGFSAQQAASQATAKTRSSQFG
VGNFQTPSSFSPMTLPGAPTTSPGAAAYPSLTNRGSNFEAGQTTGQFQTRTAEGVGVWPQ
WQGQQPHHRSSSSEQHVQQPSAQQPGQPEVFQEMLSMLGDQSSSYNNEEFPDLTMFPSFS
E
Download sequence
Identical sequences ENSTBEP00000004286 ENSTBEP00000004286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]