SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004371 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004371
Domain Number 1 Region: 346-618
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.6e-84
Family Eukaryotic proteases 0.00000000311
Further Details:      
 
Domain Number 2 Region: 102-193
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-32
Family Kringle modules 0.00000747
Further Details:      
 
Domain Number 3 Region: 209-295
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-26
Family Kringle modules 0.0000126
Further Details:      
 
Domain Number 4 Region: 42-104
Classification Level Classification E-value
Superfamily GLA-domain 5.21e-20
Family GLA-domain 0.0000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004371   Gene: ENSTBEG00000005062   Transcript: ENSTBET00000005073
Sequence length 622
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4616:85127:98606:1 gene:ENSTBEG00000005062 transcript:ENSTBET00000005073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVGGLGLPGCLVLAALCGLLHSQHVFLAPRQATALLRARRANTFLEEVRKGNLERECV
EELCSYEEAFEALESPSATDLFWAKYTVCESARKPRDKHSACLEGNCAEGLGMNYRGTVN
VTRSGIECQLWKSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTNPTVRREEC
NVPVCGQEHVTVEMTPRSGGSRVNLPPSSEPCVPDRGRQYQGRLAVTTQGSPCLAWASVE
AKALSKDQDFNPAVPLVENFCRNPDGDEEGAWCYVAGAPGDFEYCDLKYCEEALEEEEEA
GDGLEEDPDRAIEGRTSTQEFQPFFNEKTFGAGEADCGLRPLFEKKSLEDATEKELLDSY
IAGRIVRGREAEVGSAPWQVMLFRKHPQELLCGASLLSERWILTAAHCLLYPPWDKNFTE
NELLVRIGKHSRNRYERNIEKIAMLEKIYIHPRYNWRENLDRDIALLKLKNPITFSDRIH
PVCLPDKETAVRLLVSGYKGRVTGWGNLKETWIASVDEVQPSALQVVNLPIVERPVCKAS
TRIRITDNMFCAGKSPEEQKRGDACEGDSGGPFVMSPFNKRWYQMGIVSWGEGCDRDGKY
GFYTHVLRLKKWIQKVIERAGA
Download sequence
Identical sequences ENSTBEP00000004371 ENSTBEP00000004371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]