SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004386 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004386
Domain Number 1 Region: 552-900
Classification Level Classification E-value
Superfamily ALDH-like 9.03e-108
Family ALDH-like 0.0000000396
Further Details:      
 
Domain Number 2 Region: 1-200
Classification Level Classification E-value
Superfamily Formyltransferase 1.57e-38
Family Formyltransferase 0.0000000699
Further Details:      
 
Domain Number 3 Region: 416-476
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000000249
Family ALDH-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004386   Gene: ENSTBEG00000005059   Transcript: ENSTBET00000005092
Sequence length 901
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2993:3197:27795:-1 gene:ENSTBEG00000005059 transcript:ENSTBET00000005092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVIGQSLFGQEVYCQLRKEGHEIVGVFTIPDKDGKADPLXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXFCSQFIPMEVIDAPRHGIIYHPSLLPKHRGASAINW
TLIHGDKKGGFTVFWADDGLDTGDILLQKECEVLPDDTVSSLYSRFLFPEGVKGMVQAVK
LIAAGRAPRLPQPEEGATYEGIQKKETAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVERDVNKRTLRMP
HQLFIGGAFVDAEGGKTCDTINPTDGSVICQVSQAQVSDVDKAVAAAKEAFESGQWXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
GSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQV
TPLTALKFAELTLKAGIPKGVINILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMSSVFFNKGENCIAAGRLFVEAAIHD
QFVQRVVEEVRKMKIGNPLDRDTNHGPQNHQAHLAKLLEYCQRGVREGARLVCGGKQVPR
PGFFFEPTVFTDVEDHMSIAKKESFGPIMIVSRFADGDVDTVLSRANATEFGLASGVFTR
DISKALYVSDRLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFE
Y
Download sequence
Identical sequences ENSTBEP00000004386 ENSTBEP00000004386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]