SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004430 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004430
Domain Number 1 Region: 67-247
Classification Level Classification E-value
Superfamily CutC-like 1.7e-45
Family CutC-like 0.0000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004430   Gene: ENSTBEG00000005150   Transcript: ENSTBET00000005141
Sequence length 251
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3440:152418:191677:1 gene:ENSTBEG00000005150 transcript:ENSTBET00000005141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATNGFLMEVCVDSVASAVNAERGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXFLYSDREVEVMKADQLAKLYGADGLVFGALTEDGHIDKELCLSLVAMCRPLPV
TFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIDQAKGRIVVMPGG
GITDRNLQRILEGSGATEFHCSARSARDSGMKFRNFSVAMGASLSSSEYSLKVTDVTKVR
TLNAIAKNILV
Download sequence
Identical sequences ENSTBEP00000004430 ENSTBEP00000004430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]