SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004606 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004606
Domain Number 1 Region: 38-492
Classification Level Classification E-value
Superfamily ALDH-like 1.24e-114
Family ALDH-like 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004606   Gene: ENSTBEG00000005345   Transcript: ENSTBET00000005348
Sequence length 500
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1738:35029:61367:-1 gene:ENSTBEG00000005345 transcript:ENSTBET00000005348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVAATTMRARILQVSCKVKSTWYPASSFSSSSVPTVKLFIDGKFVESKSDKWIDIHN
PATNEVIGRVPQATKAEMDAAVASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAR
LITLEQGKTLADAEGDVFRGLQVVEHACSVTSLLLGETMPSITKDMDLYSYRLPLGVCAG
IAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQ
HEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAKNHGVVMPDANKENT
LNQLVGAAFGAAGQRCMALSTAILVGDAKKWLPELVERAKNLRVNAGDQPGADLGPLISP
QAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGP
VLVVLETETLDEAIKIVNDNPYGNGTAIFTTNGATARKYSHLVDVGQTGVNGPIPVPLPM
FSFTGSLSSIRGDTNFYGKQ
Download sequence
Identical sequences ENSTBEP00000004606 ENSTBEP00000004606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]