SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005126 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005126
Domain Number 1 Region: 284-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000598
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 5-53
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005126   Gene: ENSTBEG00000005949   Transcript: ENSTBET00000005956
Sequence length 766
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1402:107530:207776:-1 gene:ENSTBEG00000005949 transcript:ENSTBET00000005956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHSSRTSPLDNVGRELGSHLLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVKGQVTTKYYRFLAK
HGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQVSASKPAFSYASSS
APTMTDNRKGAKSRLSSSKSKSRTSPYPQXXXFHTERSESDHDSQWGGSPLTDTASPQLL
DPADRPGSQHDVSCAYRQFSDRSSLCYGFALDHSRLVEERHFHTQACEGGRCEAGRYFLG
TPQTGREPWWGSRAALPLTKASPESREAYENSMPHIASVHRIHGRGHWDEDSVVSSPDPG
SASESGDRYRPEQYQSSPHEPSKIETLIRATQQMIKEEENRLQLRKAPADQLASINGAGK
KHSLCFANYQQPPPTGEVCHGSALANTSPCDHIQQREGKMLSPHDNDYDNSPTALSRISS
PNSDRISKSSLILAKDYLHSDMSPHQTAGDHPAVSPNCFGSHRQYFDKHAYTLTGYALEH
LYDSETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS
Download sequence
Identical sequences ENSTBEP00000005126 ENSTBEP00000005126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]