SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005179 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005179
Domain Number 1 Region: 81-199
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-28
Family FKBP immunophilin/proline isomerase 0.00000347
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000005179
Domain Number - Region: 23-83
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00849
Family Mevalonate 5-diphosphate decarboxylase 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005179   Gene: ENSTBEG00000006017   Transcript: ENSTBET00000006019
Sequence length 201
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_829:34369:47741:-1 gene:ENSTBEG00000006017 transcript:ENSTBET00000006019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGAPQRATVQLGSELKKDFKFWQEHGSKSFLAEHKLLGNIKNVAKTANKDHLVTAYNH
LFESKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETQDEGPPKYTKSILKKGDKTNFP
KKGDVVHCWYTGTLQDGTVFDTNIQTSSKKKKSAKPLSFKVGIGKVIRGWDEALLTMSKG
EKARLEIEPEWAYGKKGQPDA
Download sequence
Identical sequences ENSTBEP00000005179 ENSTBEP00000005179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]