SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005276 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005276
Domain Number 1 Region: 669-856
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-46
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 400-575,605-665
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.28e-40
Family Voltage-gated potassium channels 0.003
Further Details:      
 
Domain Number 3 Region: 38-133
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.5e-20
Family Flavin-binding PAS domain 0.0000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005276   Gene: ENSTBEG00000006115   Transcript: ENSTBET00000006132
Sequence length 1192
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2959:809656:1041211:-1 gene:ENSTBEG00000006115 transcript:ENSTBET00000006132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKKHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHVIPVKNQEG
VAMMFIINFEYVTDEENAASPERVNPILPVKTVNRKLFGFKFPGLRVLTYRKQSLPQEDP
DVVIDSSKHSDDSVAMKHFKSPTKKSCSPSEADGYKKPLXXPSKCSPLVNISGPLDHSSP
KRQWDRLYPDMLQSSSQLTHSRSKESLCSIRRASSVHDIEGFSVHPQNIFRDRHASEDNG
RNVKFSHIKWSLLGSTSDSNLNKYSTINKIPQLTLNFSDVKTEKKNTSPPSSDKTIIAPK
VKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIYTA
IFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEEVV
SDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARKLD
RYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYNDS
DSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTSEKIFSICVMLIGSLMYASIFGNVS
AIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVLKGF
PECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLTALY
FLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQREDLLE
VLDMYPEFSDHFLTNLELTFNLRHESAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XSTNDPEDSADTIRHYQSSKKHFEEKKSRSASFISSIDDEQKPLFAGIVDSSSGIGKATG
LDFEETVPTSGRIHIDKRSHSCKDTSDTRSWERENGLSQTEECSPSALQPAAWGISETES
DLTYGEVEQRLDVLQEQLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMVTAGAEYQRPV
MPLMRTSRPAASFKTDQSFGPSSQCPEFLDLEKSKLKSKESPSSGAHLNTASEDNLTSLL
KQESDLSVEPHVRQRKTDLHPIRHPSLPDSSLSTVGMLGLHRHVSDPGLPGK
Download sequence
Identical sequences ENSTBEP00000005276 ENSTBEP00000005276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]