SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005470 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005470
Domain Number 1 Region: 183-290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-25
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-24
Family Kringle modules 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005470   Gene: ENSTBEG00000006349   Transcript: ENSTBET00000006350
Sequence length 438
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_807:2097:55980:1 gene:ENSTBEG00000006349 transcript:ENSTBET00000006350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFTANGVDYRRTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGDHNYCRNPDGDV
SPWCYVAEHEDGVYWKYCDIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFC
RSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHSQPCGGDGRIILFDTLV
GACGGNYSAMTSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFNFTLFDIRDSADMVELL
DGYTHRVLVRFNGRNRPPLSFNVTLDFVILYFFSDRINQAQGFAVLYQAVKKEPPQERPT
VNQTLAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSSSAASVGAGSYKVEXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSHRVPASGDLRDCHQPGTSGEIWSIFYKPSTSIS
IFKKKLKGQSQHDDRNPL
Download sequence
Identical sequences ENSTBEP00000005470 ENSTBEP00000005470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]