SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005515 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005515
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 2.45e-84
Family Integrin A (or I) domain 0.000000214
Further Details:      
 
Domain Number 2 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000188
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Integrin beta EGF-like domains 0.0037
Further Details:      
 
Domain Number 4 Region: 638-679
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000392
Family Integrin beta tail domain 0.0051
Further Details:      
 
Domain Number 5 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000005515
Domain Number - Region: 520-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0265
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005515   Gene: ENSTBEG00000006390   Transcript: ENSTBET00000006404
Sequence length 785
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3211:44525:75879:-1 gene:ENSTBEG00000006390 transcript:ENSTBET00000006404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQLAFWLGLIVSVCCVFGQTDENRCLKVNAKSCGECIQAGPNCGWCTNATFLQEGMPT
SARCDDLEALKKKGCHPDDIENPRGSKHIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGR
CHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSSCM
AANGQICNGRGVCECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCKAFNKGEKKDT
CAQECSHFNITKVEKQEKPQPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTVKIL
FIRAQ
Download sequence
Identical sequences ENSTBEP00000005515 ENSTBEP00000005515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]