SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005577 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005577
Domain Number 1 Region: 323-379
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000193
Family VPS37 C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005577   Gene: ENSTBEG00000006480   Transcript: ENSTBET00000006475
Sequence length 395
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1009:121384:173649:1 gene:ENSTBEG00000006480 transcript:ENSTBET00000006475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLLPLTKSASSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNNL
TININIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTMHSRLGKIQSLLDE
FWKNPPVLAPTSTAFPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISQNGFGYKMPDVPDAFPELSELSVSQL
TDMNEQEEILLEQFVTLPQLKQIITDKNDLVRSIEELARKNLLLEPSLEAKRQTVLDKYE
LLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEIDDF
LSSFMEKRTICHCRRAKEEKLQQVIAMHSQFHAPL
Download sequence
Identical sequences ENSTBEP00000005577 ENSTBEP00000005577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]