SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005601 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005601
Domain Number 1 Region: 293-526
Classification Level Classification E-value
Superfamily ALDH-like 6.81e-50
Family ALDH-like 0.0000309
Further Details:      
 
Domain Number 2 Region: 130-205
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000694
Family ALDH-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005601   Gene: ENSTBEG00000006495   Transcript: ENSTBET00000006502
Sequence length 542
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3598:7334:34365:-1 gene:ENSTBEG00000006495 transcript:ENSTBET00000006502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XSPFNHRHRVAKFCYADKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXGKTVIQAEIDAAAELIDFFRFNAKFAMELEGEQPLSVPPSTNSVVYRGLE
GFVAAISPFNFTAIGGNLAGAPALMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGGKNFH
FVHRSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPRSLWPQIKGRLLEEHGRVKVGDXX
XXXXXXXXXXXXXXSFSRIRKWLEHAHSSPSLTVLAGGKCDDAVGYFVEPCIIESKDPQE
PIMKEXIFGPVQTDPLGPDDEYKETLQLVDSTTSYGLTGAVFAQDKDVIREATKMLRNAA
GNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHAPLGDWRYSY
MQ
Download sequence
Identical sequences ENSTBEP00000005601 ENSTBEP00000005601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]