SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005617 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005617
Domain Number 1 Region: 182-300
Classification Level Classification E-value
Superfamily ApaG-like 1.01e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 21-88,115-145
Classification Level Classification E-value
Superfamily YccV-like 0.00000000000432
Family YccV-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005617   Gene: ENSTBEG00000006516   Transcript: ENSTBET00000006521
Sequence length 313
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1251:34785:40864:-1 gene:ENSTBEG00000006516 transcript:ENSTBET00000006521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRPEGKVKTVGVFEVPKQNGKYETGQLFLHSVFGYRGVVLFPWQARLYDRDVASAAPEKA
ENPAGHSSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDY
VSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHR
ETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLET
VRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLES
NKDEKTPPSGLHW
Download sequence
Identical sequences ENSTBEP00000005617 ENSTBEP00000005617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]