SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005632 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005632
Domain Number 1 Region: 475-811
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.4e-82
Family alpha-mannosidase, C-terminal domain 0.00051
Further Details:      
 
Domain Number 2 Region: 224-325
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 3.6e-27
Family alpha-mannosidase, domain 2 0.0015
Further Details:      
 
Domain Number 3 Region: 1-56
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.63e-16
Family alpha-mannosidase 0.0023
Further Details:      
 
Domain Number 4 Region: 342-386
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000847
Family alpha-mannosidase, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005632   Gene: ENSTBEG00000006511   Transcript: ENSTBET00000006537
Sequence length 881
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_101:3394:26238:1 gene:ENSTBEG00000006511 transcript:ENSTBET00000006537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGFLYETFGVRSRFSWHVDPFGASATTPTLFALAGFNAHLISRIDYNLKNAMQEAQXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLQAWTGFYTSRSALKGLA
RHAGALLYAGESLFTRYMWPAPLGTLDPAWALQQLQQLRWAVSEVQHHDAITGTESPKVR
DMYEEHLAAGMLGVRKVMAAIILDRLRPAEQARQAAPAADSGPAGRSAVVYNPLAWTVTT
IFTLTVGFPRVSVTDESGLPVPAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSNR
TVRVTQEFLEYHVNDDLTQGQLLSDNYMFTPKEAAVPAWKAVGMEVVVGKLQTEIRQYFY
RNMAAQDYTYAIFTRLAHVPRGGDGELLCHRIEQEYRAGPLELNREAIVRTSTDLDSQRV
IYSDNNGYQMQRRPYQAYAENSIARNYYPMVQSAFIQDSRSRLVLLSERAHGISSQRTGQ
VEVMLHRRLWNNFYWDLNYNLTLNDTSVVRPVIWLLLGPWPVTTALRQRSALALQHRPIV
LFGELAATARKSPGPQQQEAVTLPPNLHLQILSIPGWNYSSEHTEHMQNLKKGHRGKAQA
DLRCVLLRLHHLYETGEDPVLSRPVTVNLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRTFFIHFQQQ
Download sequence
Identical sequences ENSTBEP00000005632 ENSTBEP00000005632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]