SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005653 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005653
Domain Number 1 Region: 330-378
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000855
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.038
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000005653
Domain Number - Region: 181-236
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0715
Family N-terminal PAS domain of Pas kinase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005653   Gene: ENSTBEG00000006540   Transcript: ENSTBET00000006564
Sequence length 1134
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2282:57478:377699:-1 gene:ENSTBEG00000006540 transcript:ENSTBET00000006564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYVELPPGPSSPTKELAEPTPGQAPLQEDVDMSSGSSGNENSMGQDSQGSDCDDSRKE
LGMLVEPSDACQSASAFSLMMAKSEHTPPASGCSSEQSAKADTHRELVKTLKELKVHLPA
DKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMASESHPCGADVPSYSTDEIESVTSE
YLVKNPDMFAVAVSLSTGKVLYISDQVASIFHCKRDAFSDAKFVEFLAPHDVSVFHSSTT
PYRLPSWSICGRVDSFTQECTEEKSFFCRVSVGKSHENEVRYHPFRMTPYLVKVRDRPAA
ESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGFLPQDLIQT
PVLMQLHPSDRPLMLAIHKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXM
QSRSLMETVPAAEKDSSGGGFPEELACKSQPACSYQQVSCLDSVIRYLESCSEAATLKRK
CEFPANIPTPKSSDRRKATLSPGLRSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXMVEDAASGTESLDCLAGPSLPCGHGQEKEPFQKLGLT
KEILAAHTQKEEQSFLHKFREARRLSLWQPHCHYLQERAKGQGGERXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTSRASNHSQPCGSPATLT
TTPPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXNVDTVLKEDREKLTLLRKAQPRFTESQKRELREVHPWVQTGGLPTAIEVT
Download sequence
Identical sequences ENSTBEP00000005653 ENSTBEP00000005653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]