SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005716 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005716
Domain Number 1 Region: 1013-1107
Classification Level Classification E-value
Superfamily PRC-barrel domain 6.28e-40
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005716   Gene: ENSTBEG00000006620   Transcript: ENSTBET00000006635
Sequence length 1112
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2192:3462:13422:-1 gene:ENSTBEG00000006620 transcript:ENSTBET00000006635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PASQPTPFALHQAVGYDVEPGSGDSVSLARSISKDSLASSVVHLTPQNQPQPAAVHGQSL
LSNVSVEDEEEELVAIIRTDAAPCRGDPEAPRLSPRSPGLRAGARSPQRHADTLGSRPDS
FFLEPLMPAVLRPAKEKQVTTKEDERGEGRPRGASCKRSSEGHQPLVRKRAPSGPGSRDP
NRTFTPIPGPELPSGVSPAEPGLTGDARGGSVVSSFEVTRGQPADGFFLHLSRADEDPEG
RLCVSCTESPSSRDSEPWTLLRQDSGSDVAEMEEAVHSFLGDDHPVVITGYGGEEESAKL
QEDMKVKEHEDKDDASGRSSPCLSTTSQMSSVSMASGSVKMTSFAERKLLRLNSCETRSS
TSSSQKTTPDASESCPAPLTTWRQKREQSPGRHGKDPASLLASELAQLHMQLEEKRRAIE
AQKKKMEALSARQRLQLGKAAFLHVVKKGRADGAAQPLRPEHLTKEYAQHNGEGFGEGVL
KTGELLVKDEQRAGLLSEPRDMDKESLAVLHLHKPRDPALEVERGRALLEDGAGEADVRE
CDLSIEKLSETISTLQQAILKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLSRFFSGS
HPTSLGWESPAAPGGEPPEKALLDSCRLHDESNQRTPAPAPGRDTNVLAEQRGSRDAPET
RGKEAGLGCAGPAEEPLRGKAGLIEVDLSGLRAPDEDGETAAPDGSAELVNDGDQKPGVG
FFFKDEQKAEDELAKKRAAFLLKQQRKAEEARMRKQQLEAEVELKRDEARRKAEEDRVRK
EEEKARREFIKQEYLRRKQQQVLEEQGLGKPKPKPRKPRPKSVHREESCGGDSGAKAATP
DNLSRTQSGSSLSLAATTTEPESVHSGGTPSQRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEKCDAN
HYIILFRDAGCQFRALYCYYPDTEEICKLAGTGPKSIAKKMVDKLYKYSSDRKQFSLIPA
KTMSVSVDALTIHNHLWQPKRPAAPKKSQPRK
Download sequence
Identical sequences ENSTBEP00000005716 ENSTBEP00000005716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]