SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005832 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005832
Domain Number 1 Region: 112-211,385-441
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.08e-42
Family Matrix metalloproteases, catalytic domain 0.000000845
Further Details:      
 
Domain Number 2 Region: 334-388
Classification Level Classification E-value
Superfamily Kringle-like 7.71e-22
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 3 Region: 272-329
Classification Level Classification E-value
Superfamily Kringle-like 2.71e-21
Family Fibronectin type II module 0.0001
Further Details:      
 
Domain Number 4 Region: 216-271
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-21
Family Fibronectin type II module 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005832   Gene: ENSTBEG00000006749   Transcript: ENSTBET00000006758
Sequence length 441
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_858:6911:10175:1 gene:ENSTBEG00000006749 transcript:ENSTBET00000006758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWQPLGLALLVLGCCSAAPPRHQPTFVVFPRDLKTNLTDRQLAEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPRCGPLEVGFQFEGDLLWHHHDIT
YWIQNYSEDLPRDVIDDAFARAFAVWSAVTPLRFTRVYGQEADIVIQFGVAEHGDGYPFD
GKDGLLAHAFPPGPGIQGDAHFDDEELWTLGEGVVVQTHFGNANGAPCHFPFTFEGRTYS
ACTTDGRSDGMLWCSTTADYDKDRQFGFCPSETLYTQDGNANGEPCQFPFIFEGRSYSAC
TTDGRSDGYRWCATTANYDQDKLYGFCPTRADSTVTGGNSPGEQCVFPFVFLGKEYSSCT
SEGRRDGLLWCATTSNFDSDKKWGFCPDRGYSLFLVAAHEFGHALGLDHSSVPEALMYPM
YRFTDEPPLHEDDVRGIQHLY
Download sequence
Identical sequences ENSTBEP00000005832 ENSTBEP00000005832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]