SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006010 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006010
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000249
Family LysM domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006010   Gene: ENSTBEG00000006976   Transcript: ENSTBET00000006961
Sequence length 227
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2909:306949:321275:-1 gene:ENSTBEG00000006976 transcript:ENSTBET00000006961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPLGGSGLLHGSRTRSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEEVQPSKDEVWPHS
AERKKQETGSGHANGEALPTSGQAPPTPVHDLSASDFLKKLDSQISLSKKAAAQKLKKGD
SGVPGEDAGLHLSSPRMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences L8Y2W8
ENSTBEP00000006010 ENSTBEP00000006010 XP_006168490.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]