SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006200 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000006200
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.00509
Family Carbonic anhydrase 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006200   Gene: ENSTBEG00000007185   Transcript: ENSTBET00000007179
Sequence length 149
Comment pep:novel scaffold:TREESHREW:scaffold_102658:6961:15048:-1 gene:ENSTBEG00000007185 transcript:ENSTBET00000007179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHNAVRFENFKDAVLNENGLAVIGVFLKTPRGSGSPNRTTGPELPGQELRPAPQPGPRPR
TARHLQAPGPCQALSCRPERWGQTQPLPTPPCWDYAGGHRARLPGAKDRRRLPHRRTPQS
IGPGFIHAGLKGSELWLRKVRNLGRPAAR
Download sequence
Identical sequences ENSTBEP00000006200 ENSTBEP00000006200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]